PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M00679.1.p
Common NameMIMGU_mgv1a023556mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 105aa    MW: 12129.8 Da    PI: 7.5138
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M00679.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB123.39.7e-39188895
             NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                      +Pi+n++rim++vlPa+a+i++dake +qecvsefisf+t+ea+ +c+r+ r+t++++d+l +  +lGf+dy+epl+++l+k+r  +g
  Migut.M00679.1.p  1 MPISNITRIMRRVLPAHARITDDAKEAIQECVSEFISFITTEANRRCHRDYRNTVTPEDVLATTVSLGFDDYLEPLTLFLNKHRTQQG 88
                      8***********************************************************************************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.3E-20161IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.108.9E-37191IPR009072Histone-fold
SuperFamilySSF471131.13E-29192IPR009072Histone-fold
PRINTSPR006155.5E-142846No hitNo description
PRINTSPR006155.5E-144765No hitNo description
PRINTSPR006155.5E-146684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MPISNITRIM RRVLPAHARI TDDAKEAIQE CVSEFISFIT TEANRRCHRD YRNTVTPEDV  60
LATTVSLGFD DYLEPLTLFL NKHRTQQGPD RDSTIQLPQF VRRGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-32184992NF-YB
4awl_B3e-321841093NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-321841093NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012836455.13e-66PREDICTED: nuclear transcription factor Y subunit B-6-like
SwissprotQ84W664e-40NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A022RDA72e-69A0A022RDA7_ERYGU; Uncharacterized protein
STRINGGSMUA_Achr3P04310_0015e-40(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-41nuclear factor Y, subunit B6